ABHD14B (NM_032750) Human Recombinant Protein
CAT#: TP303520
Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), 20 µg
View other "ABHD14B" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203520 protein sequence
Red=Cloning site Green=Tags(s) MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116139 |
Locus ID | 84836 |
UniProt ID | Q96IU4 |
Refseq Size | 2447 |
Cytogenetics | 3p21.2 |
Refseq ORF | 630 |
Synonyms | CIB; HEL-S-299 |
Summary | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409958 | ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431791 | ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409958 | Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 1 |
CNY 3,080.00 |
|
LY431791 | Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 2 |
CNY 3,080.00 |
|
PH303520 | ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) |
CNY 19,520.00 |
|
TP328763 | Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它ABHD14B产品