COPS4 (NM_016129) Human Recombinant Protein
CAT#: TP303441
Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) (COPS4), 20 µg
View other "COPS4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203441 protein sequence
Red=Cloning site Green=Tags(s) MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFC THLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYN VDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNE LSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQE FAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNG FIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057213 |
Locus ID | 51138 |
UniProt ID | Q9BT78, A0A0S2Z5H7, B3KM48 |
Refseq Size | 1765 |
Cytogenetics | 4q21.22 |
Refseq ORF | 1218 |
Synonyms | CSN4; SGN4 |
Summary | This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402507 | COPS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402507 | Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) (COPS4) |
CNY 3,080.00 |
|
PH303441 | COPS4 MS Standard C13 and N15-labeled recombinant protein (NP_057213) |
CNY 19,520.00 |