RABL5 (IFT22) (NM_022777) Human Recombinant Protein
CAT#: TP303375
Recombinant protein of human RAB, member RAS oncogene family-like 5 (RABL5), transcript variant 1, 20 µg
View other "RABL5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203375 protein sequence
Red=Cloning site Green=Tags(s) MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKF ESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPL NKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073614 |
Locus ID | 64792 |
UniProt ID | Q9H7X7 |
Refseq Size | 2439 |
Cytogenetics | 7q22.1 |
Refseq ORF | 555 |
Synonyms | FAP9; RABL5 |
Summary | Small GTPase-like component of the intraflagellar transport (IFT) complex B.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411566 | IFT22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411566 | Transient overexpression lysate of RAB, member RAS oncogene family-like 5 (RABL5), transcript variant 1 |
CNY 3,080.00 |
|
PH303375 | RABL5 MS Standard C13 and N15-labeled recombinant protein (NP_073614) |
CNY 19,520.00 |