QPRT (NM_014298) Human Recombinant Protein
CAT#: TP302960
Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT), 20 µg
View other "QPRT" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202960 protein sequence
Red=Cloning site Green=Tags(s) MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQ VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQ AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055113 |
Locus ID | 23475 |
UniProt ID | Q15274 |
Refseq Size | 1575 |
Cytogenetics | 16p11.2 |
Refseq ORF | 891 |
Synonyms | HEL-S-90n; QPRTase |
Summary | This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402307 | QPRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402307 | Transient overexpression lysate of quinolinate phosphoribosyltransferase (QPRT) |
CNY 3,080.00 |
|
PH302960 | QPRT MS Standard C13 and N15-labeled recombinant protein (NP_055113) |
CNY 19,520.00 |
|
TP720230 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT) |
CNY 3,140.00 |