RTN4IP1 (NM_032730) Human Recombinant Protein
CAT#: TP302957
Recombinant protein of human reticulon 4 interacting protein 1 (RTN4IP1), nuclear gene encoding mitochondrial protein, 20 µg
View other "RTN4IP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202957 protein sequence
Red=Cloning site Green=Tags(s) MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHY PNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLI LGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGS TETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCL DDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116119 |
Locus ID | 84816 |
UniProt ID | Q8WWV3 |
Refseq Size | 2636 |
Cytogenetics | 6q21 |
Refseq ORF | 1188 |
Synonyms | NIMP; OPA10 |
Summary | This gene encodes a mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. This interaction may be important for reticulon-induced inhibition of neurite growth. Mutations in this gene can cause optic atrophy 10, with or without ataxia, cognitive disability, and seizures. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409966 | RTN4IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409966 | Transient overexpression lysate of reticulon 4 interacting protein 1 (RTN4IP1), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH302957 | RTN4IP1 MS Standard C13 and N15-labeled recombinant protein (NP_116119) |
CNY 19,520.00 |
其它RTN4IP1产品