NUDT3 (NM_006703) Human Recombinant Protein
CAT#: TP302900
Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 3 (NUDT3), 20 µg
View other "NUDT3" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202900 representing NM_006703
Red=Cloning site Green=Tags(s) MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006694 |
Locus ID | 11165 |
UniProt ID | O95989 |
Refseq Size | 1371 |
Cytogenetics | 6p21.31 |
Refseq ORF | 516 |
Synonyms | DIPP; DIPP-1; DIPP1 |
Summary | NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH302900 | NUDT3 MS Standard C13 and N15-labeled recombinant protein (NP_006694) |
CNY 14,250.00 |