HAX1 (NM_006118) Human Recombinant Protein
CAT#: TP302690
Recombinant protein of human HCLS1 associated protein X-1 (HAX1), transcript variant 1, 20 µg
View other "HAX1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202690 protein sequence
Red=Cloning site Green=Tags(s) MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006109 |
Locus ID | 10456 |
UniProt ID | O00165 |
Refseq Size | 1196 |
Cytogenetics | 1q21.3 |
Refseq ORF | 837 |
Synonyms | HCLSBP1; HS1BP1; SCN3 |
Summary | The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401845 | HAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422672 | HAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401845 | Transient overexpression lysate of HCLS1 associated protein X-1 (HAX1), transcript variant 1 |
CNY 3,080.00 |
|
LY422672 | Transient overexpression lysate of HCLS1 associated protein X-1 (HAX1), transcript variant 2 |
CNY 3,080.00 |
|
PH302690 | HAX1 MS Standard C13 and N15-labeled recombinant protein (NP_006109) |
CNY 19,520.00 |