United States
Germany
Japan
United Kingdom
China
PUS1 (NM_001002019) Human Recombinant Protein
CAT＃: TP302637
Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 2, 20 µg
View other "PUS1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202637 protein sequence
Red=Cloning site Green=Tags(s) MAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLKSGGDEERREKPPKRKIVLLMAYSGKGYH GMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILE KINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLAC YKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGY APESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTII GTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001002019 |
| Locus ID | 80324 |
| UniProt ID | Q9Y606 |
| Refseq Size | 1637 |
| Cytogenetics | 12q24.33 |
| Refseq ORF | 1197 |
| Synonyms | MLASA1 |
| Summary | This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410839 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424322 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424323 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410839 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 1 |
CNY 3,080.00 |
|
| LY424322 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 2 |
CNY 3,080.00 |
|
| LY424323 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 |
CNY 3,080.00 |
|
| PH300879 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491) |
CNY 19,520.00 |
|
| PH302637 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002019) |
CNY 19,520.00 |
|
| PH322753 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002020) |
CNY 19,520.00 |
|
| TP300879 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP322753 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 3, 20 µg |
CNY 2,900.00 |
