Apolipoprotein L 2 (APOL2) (NM_030882) Human Recombinant Protein
CAT#: TP302585
Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha, 20 µg
View other "Apolipoprotein L 2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202585 protein sequence
Red=Cloning site Green=Tags(s) MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112092 |
Locus ID | 23780 |
UniProt ID | Q9BQE5 |
Refseq Size | 2545 |
Cytogenetics | 22q12.3 |
Refseq ORF | 1011 |
Synonyms | APOL-II; APOL3 |
Summary | This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403087 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407937 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403087 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha |
CNY 3,080.00 |
|
LY407937 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant beta |
CNY 3,080.00 |
|
PH302585 | APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092) |
CNY 19,520.00 |
|
PH316858 | APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_663612) |
CNY 19,520.00 |
|
TP316858 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant beta, 20 µg |
CNY 2,900.00 |
其它Apolipoprotein L 2产品