C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein
CAT#: TP302554
Recombinant protein of human family with sequence similarity 164, member C (FAM164C), transcript variant 2, 20 µg
View other "C14ORF140" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202554 protein sequence
Red=Cloning site Green=Tags(s) MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYT HPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFP LKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEW VQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035895 |
Locus ID | 79696 |
UniProt ID | Q53FD0, A0A024R6E6 |
Refseq Size | 3471 |
Cytogenetics | 14q24.3 |
Refseq ORF | 825 |
Synonyms | C14orf140; FAM164C |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411092 | ZC2HC1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420900 | ZC2HC1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411092 | Transient overexpression lysate of family with sequence similarity 164, member C (FAM164C), transcript variant 1 |
CNY 4,840.00 |
|
LY420900 | Transient overexpression lysate of family with sequence similarity 164, member C (FAM164C), transcript variant 2 |
CNY 3,080.00 |
|
PH302554 | FAM164C MS Standard C13 and N15-labeled recombinant protein (NP_001035895) |
CNY 19,520.00 |
其它C14ORF140产品