ELMOD2 (NM_153702) Human Recombinant Protein
CAT#: TP302343
Recombinant protein of human ELMO/CED-12 domain containing 2 (ELMOD2), 20 µg
View other "ELMOD2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202343 protein sequence
Red=Cloning site Green=Tags(s) MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEV DKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMP TKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGIN LTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKG LLLDCNVALTLKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_714913 |
Locus ID | 255520 |
UniProt ID | Q8IZ81 |
Refseq Size | 4425 |
Cytogenetics | 4q31.1 |
Refseq ORF | 879 |
Synonyms | 9830169G11Rik |
Summary | This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. [provided by RefSeq, Sep 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406969 | ELMOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406969 | Transient overexpression lysate of ELMO/CED-12 domain containing 2 (ELMOD2) |
CNY 3,080.00 |
|
PH302343 | ELMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_714913) |
CNY 19,520.00 |