CD164 (NM_006016) Human Recombinant Protein
CAT#: TP302234
Recombinant protein of human CD164 molecule, sialomucin (CD164), transcript variant 1, 20 µg
View other "CD164" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202234 protein sequence
Red=Cloning site Green=Tags(s) MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006007 |
Locus ID | 8763 |
UniProt ID | Q04900 |
Refseq Size | 3128 |
Cytogenetics | 6q21 |
Refseq ORF | 591 |
Synonyms | DFNA66; endolyn; MGC-24; MGC-24v; MUC-24 |
Summary | This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. [provided by RefSeq, Oct 2016] |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416885 | CD164 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416885 | Transient overexpression lysate of CD164 molecule, sialomucin (CD164), transcript variant 1 |
CNY 3,080.00 |
|
PH302234 | CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007) |
CNY 19,520.00 |