PDCD5 (NM_004708) Human Recombinant Protein
CAT#: TP302119
Recombinant protein of human programmed cell death 5 (PDCD5), 20 µg
View other "PDCD5" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202119 protein sequence
Red=Cloning site Green=Tags(s) MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004699 |
Locus ID | 9141 |
UniProt ID | O14737 |
Refseq Size | 604 |
Cytogenetics | 19q13.11 |
Refseq ORF | 375 |
Synonyms | TFAR19 |
Summary | This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12 [provided by RefSeq, Dec 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417805 | PDCD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417805 | Transient overexpression lysate of programmed cell death 5 (PDCD5) |
CNY 3,080.00 |
|
PH302119 | PDCD5 MS Standard C13 and N15-labeled recombinant protein (NP_004699) |
CNY 19,520.00 |
|
TP720950 | Purified recombinant protein of Human programmed cell death 5 (PDCD5) |
CNY 3,140.00 |