S100A3 (NM_002960) Human Recombinant Protein
CAT#: TP302117
Recombinant protein of human S100 calcium binding protein A3 (S100A3), 20 µg
View other "S100A3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202117 protein sequence
Red=Cloning site Green=Tags(s) MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002951 |
Locus ID | 6274 |
UniProt ID | P33764 |
Refseq Size | 738 |
Cytogenetics | 1q21.3 |
Refseq ORF | 303 |
Synonyms | S100E |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418990 | S100A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418990 | Transient overexpression lysate of S100 calcium binding protein A3 (S100A3) |
CNY 3,080.00 |
|
PH302117 | S100A3 MS Standard C13 and N15-labeled recombinant protein (NP_002951) |
CNY 19,520.00 |