TMEM98 (NM_015544) Human Recombinant Protein
CAT#: TP301829L
Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 1, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201829 protein sequence
Red=Cloning site Green=Tags(s) METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD KGLPGPEGFLQEQSAI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 25946230) |
Reference Data | |
RefSeq | NP_056359 |
Locus ID | 26022 |
UniProt ID | Q9Y2Y6 |
Refseq Size | 1808 |
Cytogenetics | 17q11.2 |
Refseq ORF | 678 |
Synonyms | TADA1 |
Summary | This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |