U1A (SNRPA) (NM_004596) Human Recombinant Protein
CAT#: TP301818
Recombinant protein of human small nuclear ribonucleoprotein polypeptide A (SNRPA), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201818 protein sequence
Red=Cloning site Green=Tags(s) MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA KK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | : OriGene human recombinant small nuclear ribonucleoprotein polypeptide A (SNRPA, Cat. #TP301818) was compared side-by-side with baculovirus based insect cell (BEVS) derived SNRPA in a phycoerythrin detecting Luminex assay. The human cell produced SNRPA is comparative or better in sensitivity than the insect cell produced SNRPA to detect autoantibodies in human serum samples. |
Reference Data | |
RefSeq | NP_004587 |
Locus ID | 6626 |
UniProt ID | P09012 |
Refseq Size | 1646 |
Cytogenetics | 19q13.2 |
Refseq ORF | 846 |
Synonyms | Mud1; U1-A; U1A |
Summary | The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417878 | SNRPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417878 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide A (SNRPA) |
CNY 3,080.00 |
|
PH301818 | SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587) |
CNY 19,520.00 |