LANPL (ANP32E) (NM_030920) Human Recombinant Protein
CAT#: TP301677
Recombinant protein of human acidic (leucine-rich) nuclear phosphoprotein 32 family, member E (ANP32E), transcript variant 1, 20 µg
View other "LANPL" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201677 protein sequence
Red=Cloning site Green=Tags(s) MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE LSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQ QITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELG EGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112182 |
Locus ID | 81611 |
UniProt ID | Q9BTT0 |
Refseq Size | 3467 |
Cytogenetics | 1q21.2 |
Refseq ORF | 804 |
Synonyms | LANP-L; LANPL |
Summary | Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state (PubMed:24463511). Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403095 | ANP32E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403095 | Transient overexpression lysate of acidic (leucine-rich) nuclear phosphoprotein 32 family, member E (ANP32E), transcript variant 1 |
CNY 3,080.00 |
|
PH301677 | ANP32E MS Standard C13 and N15-labeled recombinant protein (NP_112182) |
CNY 19,520.00 |