Plastin L (LCP1) (NM_002298) Human Recombinant Protein
CAT#: TP301670
Recombinant protein of human lymphocyte cytosolic protein 1 (L-plastin) (LCP1), 20 µg
View other "Plastin L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201670 protein sequence
Red=Cloning site Green=Tags(s) MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRIS FDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDC RHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVN IGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLEN AGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFV TATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTL TLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAEKSSSISSFKDPKISTSLPVLDLIDAIQ PGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme subtrate (PMID: 25881549) |
Reference Data | |
RefSeq | NP_002289 |
Locus ID | 3936 |
UniProt ID | P13796 |
Refseq Size | 3808 |
Cytogenetics | 13q14.13 |
Refseq ORF | 1881 |
Synonyms | CP64; HEL-S-37; L-PLASTIN; LC64P; LPL; PLS2 |
Summary | Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
L-plastin S-glutathionylation promotes reduced binding to ß-actin and affects neutrophil functions
,Dubey, M;Singh, AK;Awasthi, D;Nagarkoti, S;Kumar, S;Ali, W;Chandra, T;Kumar, V;Barthwal, MK;Jagavelu, K;Sánchez, FJ;Lamas, S;Dikshit, M;,
Free Radic. Biol. Med.
,PubMed ID 25881549
[LCP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400831 | LCP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400831 | Transient overexpression lysate of lymphocyte cytosolic protein 1 (L-plastin) (LCP1) |
CNY 3,080.00 |
|
PH301670 | LCP1 MS Standard C13 and N15-labeled recombinant protein (NP_002289) |
CNY 19,520.00 |
其它Plastin L产品