HMGN4 (NM_006353) Human Recombinant Protein
CAT#: TP301589
Recombinant protein of human high mobility group nucleosomal binding domain 4 (HMGN4), 20 µg
View other "HMGN4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201589 protein sequence
Red=Cloning site Green=Tags(s) MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA KNRDASTLQSQKAEGTGDAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006344 |
Locus ID | 10473 |
UniProt ID | O00479 |
Refseq Size | 1980 |
Cytogenetics | 6p22.2 |
Refseq ORF | 270 |
Synonyms | HMG17L3; NHC |
Summary | The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. [provided by RefSeq, Mar 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416708 | HMGN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416708 | Transient overexpression lysate of high mobility group nucleosomal binding domain 4 (HMGN4) |
CNY 3,080.00 |
|
PH301589 | HMGN4 MS Standard C13 and N15-labeled recombinant protein (NP_006344) |
CNY 19,520.00 |