SPCS1 (NM_014041) Human Recombinant Protein
CAT#: TP301472
Recombinant protein of human signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1), 20 µg
View other "SPCS1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201472 protein sequence
Red=Cloning site Green=Tags(s) MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWP IYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054760 |
Locus ID | 28972 |
UniProt ID | Q9Y6A9 |
Refseq Size | 1100 |
Cytogenetics | 3p21.1 |
Refseq ORF | 312 |
Synonyms | HSPC033; SPC1; SPC12; YJR010C-A |
Summary | Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
Protein Families | Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415515 | SPCS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415515 | Transient overexpression lysate of signal peptidase complex subunit 1 homolog (S. cerevisiae) (SPCS1) |
CNY 3,080.00 |
|
PH301472 | SPCS1 MS Standard C13 and N15-labeled recombinant protein (NP_054760) |
CNY 19,520.00 |