RILPL2 (NM_145058) Human Recombinant Protein
CAT#: TP301447
Recombinant protein of human Rab interacting lysosomal protein-like 2 (RILPL2), 20 µg
View other "RILPL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201447 protein sequence
Red=Cloning site Green=Tags(s) MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVR VLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRD VLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQ T myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659495 |
Locus ID | 196383 |
UniProt ID | Q969X0 |
Refseq Size | 1435 |
Cytogenetics | 12q24.31 |
Refseq ORF | 633 |
Synonyms | RLP2 |
Summary | This gene encodes a protein that contains a rab-interacting lysosomal protein-like domain. This protein may be involved in regulating lysosome morphology. This protein may also be a target for the Hepatitis C virus and assist in viral replication. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408055 | RILPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408055 | Transient overexpression lysate of Rab interacting lysosomal protein-like 2 (RILPL2) |
CNY 3,080.00 |
|
PH301447 | RILPL2 MS Standard C13 and N15-labeled recombinant protein (NP_659495) |
CNY 19,520.00 |