C11orf49 (NM_024113) Human Recombinant Protein
CAT#: TP301435
Recombinant protein of human chromosome 11 open reading frame 49 (C11orf49), transcript variant 3, 20 µg
View other "C11orf49" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201435 protein sequence
Red=Cloning site Green=Tags(s) MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQA TPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFL FAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLC DRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPG LVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077018 |
Locus ID | 79096 |
UniProt ID | Q9H6J7 |
Refseq Size | 1746 |
Cytogenetics | 11p11.2 |
Refseq ORF | 993 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411347 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424096 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424097 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424098 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411347 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 3 |
CNY 3,080.00 |
|
LY424096 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 1 |
CNY 3,080.00 |
|
LY424097 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 2 |
CNY 3,080.00 |
|
LY424098 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 4 |
CNY 3,080.00 |
|
PH301435 | C11orf49 MS Standard C13 and N15-labeled recombinant protein (NP_077018) |
CNY 19,520.00 |
|
TP760102 | Recombinant protein of human chromosome 11 open reading frame 49 (C11orf49), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP761377 | Purified recombinant protein of Human chromosome 11 open reading frame 49 (C11orf49), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它C11orf49产品