PSF3 (GINS3) (NM_022770) Human Recombinant Protein
CAT#: TP301425
Recombinant protein of human GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2, 20 µg
View other "PSF3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201425 protein sequence
Red=Cloning site Green=Tags(s) MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPL WLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQ TFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRK FTDMED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073607 |
Locus ID | 64785 |
UniProt ID | Q9BRX5 |
Refseq Size | 2297 |
Cytogenetics | 16q21 |
Refseq ORF | 648 |
Synonyms | PSF3 |
Summary | This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411561 | GINS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411561 | Transient overexpression lysate of GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2 |
CNY 3,080.00 |
|
PH301425 | GINS3 MS Standard C13 and N15-labeled recombinant protein (NP_073607) |
CNY 19,520.00 |