SCGN (NM_006998) Human Recombinant Protein
CAT#: TP301359
Purified recombinant protein of Homo sapiens secretagogin, EF-hand calcium binding protein (SCGN), 20 µg
View other "SCGN" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201359 representing NM_006998
Red=Cloning site Green=Tags(s) MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008929 |
Locus ID | 10590 |
UniProt ID | O76038 |
Refseq Size | 1492 |
Cytogenetics | 6p22.2 |
Refseq ORF | 828 |
Synonyms | CALBL; DJ501N12.8; SECRET; SEGN; setagin |
Summary | The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416264 | SCGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416264 | Transient overexpression lysate of secretagogin, EF-hand calcium binding protein (SCGN) |
CNY 3,080.00 |
|
PH301359 | SCGN MS Standard C13 and N15-labeled recombinant protein (NP_008929) |
CNY 14,250.00 |