United States
Germany
Japan
United Kingdom
China
SIGIRR (NM_021805) Human Recombinant Protein
CAT＃: TP301356
Purified recombinant protein of Homo sapiens single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 20 µg
View other "SIGIRR" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201356 protein sequence
Red=Cloning site Green=Tags(s) MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 45.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068577 |
| Locus ID | 59307 |
| UniProt ID | Q6IA17 |
| Refseq Size | 1657 |
| Cytogenetics | 11p15.5 |
| Refseq ORF | 1230 |
| Synonyms | IL-1R8; TIR8 |
| Summary | Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402876 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427540 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427541 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402876 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3 |
CNY 3,080.00 |
|
| LY427540 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2 |
CNY 3,080.00 |
|
| LY427541 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1 |
CNY 3,080.00 |
|
| PH301356 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_068577) |
CNY 14,250.00 |
|
| PH325642 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128525) |
CNY 19,520.00 |
|
| PH325643 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128526) |
CNY 19,520.00 |
|
| TP325642 | Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325643 | Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP762571 | Purified recombinant protein of Human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 50ug |
CNY 2,480.00 |
