ISCA1 (NM_030940) Human Recombinant Protein
CAT#: TP301335
Recombinant protein of human iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1), 20 µg
View other "ISCA1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201335 protein sequence
Red=Cloning site Green=Tags(s) MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112202 |
Locus ID | 81689 |
UniProt ID | Q9BUE6 |
Refseq Size | 2012 |
Cytogenetics | 9q21.33 |
Refseq ORF | 387 |
Synonyms | HBLD2; hIscA; ISA1; MMDS5 |
Summary | ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410656 | ISCA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410656 | Transient overexpression lysate of iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1) |
CNY 3,080.00 |
|
PH301335 | ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202) |
CNY 19,520.00 |