C1QL1 (NM_006688) Human Recombinant Protein
CAT#: TP301176
Recombinant protein of human complement component 1, q subcomponent-like 1 (C1QL1), 20 µg
View other "C1QL1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201176 protein sequence
Red=Cloning site Green=Tags(s) MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQG KPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPH EGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDAD QNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006679 |
Locus ID | 10882 |
UniProt ID | O75973 |
Refseq Size | 1517 |
Cytogenetics | 17q21.31 |
Refseq ORF | 774 |
Synonyms | C1QRF; C1QTNF14; CRF; CTRP14 |
Summary | May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416490 | C1QL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416490 | Transient overexpression lysate of complement component 1, q subcomponent-like 1 (C1QL1) |
CNY 3,080.00 |
|
PH301176 | C1QL1 MS Standard C13 and N15-labeled recombinant protein (NP_006679) |
CNY 14,250.00 |
|
TP701105 | Purified recombinant protein of Human complement component 1, q subcomponent-like 1 (C1QL1), Gly17-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,490.00 |