BAT4 (GPANK1) (NM_033177) Human Recombinant Protein
CAT#: TP301161
Recombinant protein of human HLA-B associated transcript 4 (BAT4), 20 µg
View other "BAT4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201161 protein sequence
Red=Cloning site Green=Tags(s) MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGDESSAPDSQRSQTEPARERKR KKRRIMKAPAAEAVAEGASGRHGQGRSLEAEDKMTHRILRAAQEGDLPELRRLLEPHEAGGAGGNINARD AFWWTPLMCAARAGQGAAVSYLLGRGAAWVGVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRS PTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEG RANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRT YMNLEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149417 |
Locus ID | 7918 |
UniProt ID | O95872 |
Refseq Size | 2769 |
Cytogenetics | 6p21.33 |
Refseq ORF | 1068 |
Synonyms | ANKRD59; BAT4; D6S54E; G5; GPATCH10 |
Summary | This gene is located in a cluster of HLA-B-associated transcripts, which is included in the human major histocompatability complex III region. This gene encodes a protein which is thought to play a role in immunity. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409694 | GPANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409694 | Transient overexpression lysate of HLA-B associated transcript 4 (BAT4) |
CNY 3,080.00 |
|
PH301161 | BAT4 MS Standard C13 and N15-labeled recombinant protein (NP_149417) |
CNY 19,520.00 |