CCDC56 (COA3) (NM_001040431) Human Recombinant Protein
CAT#: TP301034
Recombinant protein of human coiled-coil domain containing 56 (CCDC56), 20 µg
View other "CCDC56" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201034 protein sequence
Red=Cloning site Green=Tags(s) MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLA IYGYTFYSISQERFLDELEDEAKAARARALARASGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035521 |
Locus ID | 28958 |
UniProt ID | Q9Y2R0 |
Refseq Size | 808 |
Cytogenetics | 17q21.2 |
Refseq ORF | 318 |
Synonyms | CCDC56; COX25; HSPC009; MC4DN14; MITRAC12 |
Summary | This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function. [provided by RefSeq, Nov 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421751 | COA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421751 | Transient overexpression lysate of coiled-coil domain containing 56 (CCDC56) |
CNY 3,080.00 |
|
PH301034 | CCDC56 MS Standard C13 and N15-labeled recombinant protein (NP_001035521) |
CNY 19,520.00 |