GGCT (NM_024051) Human Recombinant Protein
CAT#: TP300962
Recombinant protein of human gamma-glutamyl cyclotransferase (GGCT), 20 µg
View other "GGCT" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200962 protein sequence
Red=Cloning site Green=Tags(s) MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076956 |
Locus ID | 79017 |
UniProt ID | O75223 |
Refseq Size | 1197 |
Cytogenetics | 7p14.3 |
Refseq ORF | 564 |
Synonyms | C7orf24; CRF21; GCTG; GGC |
Summary | The protein encoded by this gene catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides, the penultimate step in glutathione catabolism, and may play a critical role in glutathione homeostasis. The encoded protein may also play a role in cell proliferation, and the expression of this gene is a potential marker for cancer. Pseudogenes of this gene are located on the long arm of chromosome 5 and the short arm of chromosomes 2 and 20. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2010] |
Protein Pathways | Glutathione metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411391 | GGCT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411391 | Transient overexpression lysate of gamma-glutamyl cyclotransferase (GGCT) |
CNY 3,080.00 |
|
PH300962 | GGCT MS Standard C13 and N15-labeled recombinant protein (NP_076956) |
CNY 19,520.00 |
|
TP720189 | Recombinant protein of human gamma-glutamyl cyclotransferase (GGCT) |
CNY 3,140.00 |