United States
Germany
Japan
United Kingdom
China
RUNX1T1 (NM_175636) Human Recombinant Protein
CAT＃: TP300898
Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4, 20 µg
View other "RUNX1T1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200898 protein sequence
Red=Cloning site Green=Tags(s) MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSS SLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPL RPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDR TKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRH PSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE ELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVK RQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCS GCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPS TIETTPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_783554 |
| Locus ID | 862 |
| UniProt ID | Q06455 |
| Refseq Size | 7319 |
| Cytogenetics | 8q21.3 |
| Refseq ORF | 1701 |
| Synonyms | AML1-MTG8; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2 |
| Summary | This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010] |
| Protein Families | Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Pathways in cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403575 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406255 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406277 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC430432 | RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403575 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3 |
CNY 3,080.00 |
|
| LY406255 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4 |
CNY 3,080.00 |
|
| LY406277 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 |
CNY 4,840.00 |
|
| LY430432 | Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 |
CNY 3,080.00 |
|
| PH300898 | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783554) |
CNY 19,520.00 |
|
| PH322426 | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783553) |
CNY 19,520.00 |
|
| TP322426 | Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它RUNX1T1产品
