DCUN1D5 (NM_032299) Human Recombinant Protein
CAT#: TP300870
Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5), 20 µg
View other "DCUN1D5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200870 protein sequence
Red=Cloning site Green=Tags(s) MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD LSNYDEDGAWPVLLDEFVEWQKVRQTS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115675 |
Locus ID | 84259 |
UniProt ID | Q9BTE7 |
Refseq Size | 12732 |
Cytogenetics | 11q22.3 |
Refseq ORF | 711 |
Synonyms | SCCRO5 |
Summary | Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs) (PubMed:26906416, PubMed:23201271, PubMed:19617556). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth (PubMed:23098533, PubMed:24192928).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410241 | DCUN1D5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410241 | Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) |
CNY 3,080.00 |
|
PH300870 | DCUN1D5 MS Standard C13 and N15-labeled recombinant protein (NP_115675) |
CNY 19,520.00 |
其它DCUN1D5产品