IFIT3 (NM_001549) Human Recombinant Protein
CAT#: TP300610
Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1, 20 µg
View other "IFIT3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200610 protein sequence
Red=Cloning site Green=Tags(s) MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001540 |
Locus ID | 3437 |
UniProt ID | O14879 |
Refseq Size | 2578 |
Cytogenetics | 10q23.31 |
Refseq ORF | 1470 |
Synonyms | CIG-49; cig41; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G |
Summary | IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400593 | IFIT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421898 | IFIT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400593 | Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1 |
CNY 3,080.00 |
|
LY421898 | Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2 |
CNY 4,840.00 |
|
PH300610 | IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001540) |
CNY 19,520.00 |
|
PH314701 | IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001026853) |
CNY 19,520.00 |
|
TP314701 | Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2, 20 µg |
CNY 2,900.00 |