Apoptosis repressor with CARD (NOL3) (NM_003946) Human Recombinant Protein
CAT#: TP300591
Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), 20 µg
View other "Apoptosis repressor with CARD" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200591 protein sequence
Red=Cloning site Green=Tags(s) MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003937 |
Locus ID | 8996 |
UniProt ID | O60936, Q5TZN6 |
Refseq Size | 1540 |
Cytogenetics | 16q22.1 |
Refseq ORF | 624 |
Synonyms | ARC; FCM; MYOCL1; MYP; NOP; NOP30 |
Summary | This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401296 | NOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401296 | Transient overexpression lysate of nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3) |
CNY 3,080.00 |
|
PH300591 | NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937) |
CNY 19,520.00 |
|
TP720132 | Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 3. |
CNY 3,140.00 |
其它Apoptosis repressor with CARD产品