Synaptogyrin 1 (SYNGR1) (NM_145731) Human Recombinant Protein
CAT#: TP300562
Recombinant protein of human synaptogyrin 1 (SYNGR1), transcript variant 1b, 20 µg
View other "Synaptogyrin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200562 protein sequence
Red=Cloning site Green=Tags(s) MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSY GVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPL NEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663783 |
Locus ID | 9145 |
UniProt ID | O43759 |
Refseq Size | 1341 |
Cytogenetics | 22q13.1 |
Refseq ORF | 573 |
Summary | This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Identification of Synaptic DGKθ Interactors That Stimulate DGKθ Activity
,null,
Frontiers in Synaptic Neuroscience
,PubMed ID 35573662
[SYNGR1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407866 | SYNGR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407866 | Transient overexpression lysate of synaptogyrin 1 (SYNGR1), transcript variant 1b |
CNY 3,080.00 |
|
PH300562 | SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783) |
CNY 19,520.00 |
其它Synaptogyrin 1产品