LDOC1 (NM_012317) Human Recombinant Protein
CAT#: TP300543
Recombinant protein of human leucine zipper, down-regulated in cancer 1 (LDOC1), 20 µg
View other "LDOC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200543 protein sequence
Red=Cloning site Green=Tags(s) MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE EEEDDY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036449 |
Locus ID | 23641 |
UniProt ID | O95751 |
Refseq Size | 1470 |
Cytogenetics | Xq27.1 |
Refseq ORF | 438 |
Synonyms | BCUR1; Mar7; Mart7; RTL7; SIRH7 |
Summary | The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402194 | LDOC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402194 | Transient overexpression lysate of leucine zipper, down-regulated in cancer 1 (LDOC1) |
CNY 3,080.00 |
|
PH300543 | LDOC1 MS Standard C13 and N15-labeled recombinant protein (NP_036449) |
CNY 19,520.00 |