CD52 (NM_001803) Human Recombinant Protein
CAT#: TP300493
Recombinant protein of human CD52 molecule (CD52), 20 µg
View other "CD52" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200493 protein sequence
Red=Cloning site Green=Tags(s) MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 6.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001794 |
Locus ID | 1043 |
UniProt ID | P31358 |
Refseq Size | 523 |
Cytogenetics | 1p36.11 |
Refseq ORF | 183 |
Synonyms | CDW52; EDDM5; HE5 |
Summary | May play a role in carrying and orienting carbohydrate, as well as having a more specific role.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |