PRMT2 (NM_206962) Human Recombinant Protein
CAT#: TP300461
Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 1, 20 µg
View other "PRMT2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200461 protein sequence
Red=Cloning site Green=Tags(s) MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPT SQKVGEKVFPIWR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 48.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996845 |
Locus ID | 3275 |
UniProt ID | P55345, A0A0S2Z3N3 |
Refseq Size | 2446 |
Cytogenetics | 21q22.3 |
Refseq ORF | 1299 |
Synonyms | HRMT1L1 |
Summary | Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400590 | PRMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404196 | PRMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400590 | Transient overexpression lysate of protein arginine methyltransferase 2 (PRMT2), transcript variant 2 |
CNY 3,080.00 |
|
LY404196 | Transient overexpression lysate of protein arginine methyltransferase 2 (PRMT2), transcript variant 1 |
CNY 3,080.00 |
|
PH300461 | PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_996845) |
CNY 19,520.00 |
|
PH318590 | PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001526) |
CNY 19,520.00 |
|
TP318590 | Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 2, 20 µg |
CNY 2,900.00 |