Torsin A (TOR1A) (NM_000113) Human Recombinant Protein
CAT#: TP300389
Recombinant protein of human torsin family 1, member A (torsin A) (TOR1A), 20 µg
View other "Torsin A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200389 protein sequence
Red=Cloning site Green=Tags(s) MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLF GQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPH ASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAG AERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC IRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000104 |
Locus ID | 1861 |
UniProt ID | O14656 |
Refseq Size | 2117 |
Cytogenetics | 9q34.11 |
Refseq ORF | 996 |
Synonyms | AMC5; DQ2; DYT1 |
Summary | The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400035 | TOR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400035 | Transient overexpression lysate of torsin family 1, member A (torsin A) (TOR1A) |
CNY 3,080.00 |
|
PH300389 | TOR1A MS Standard C13 and N15-labeled recombinant protein (NP_000104) |
CNY 19,520.00 |
其它Torsin A产品