UXT (NM_004182) Human Recombinant Protein
CAT#: TP300343
Recombinant protein of human ubiquitously-expressed transcript (UXT), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200343 protein sequence
Red=Cloning site Green=Tags(s) MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE GLRELQGLQNFPEKPHH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004173 |
Locus ID | 8409 |
UniProt ID | Q9UBK9 |
Refseq Size | 619 |
Cytogenetics | Xp11.23 |
Refseq ORF | 471 |
Synonyms | ART-27; STAP1 |
Summary | The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418160 | UXT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418160 | Transient overexpression lysate of ubiquitously-expressed transcript (UXT), transcript variant 2 |
CNY 3,080.00 |
|
PH300343 | UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173) |
CNY 19,520.00 |