USP14 (NM_005151) Human Recombinant Protein
CAT#: TP300337
Recombinant protein of human ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 1, 20 µg
View other "USP14" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200337 protein sequence
Red=Cloning site Green=Tags(s) MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLL MMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL RASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRV LQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFIN QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEE ESEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005142 |
Locus ID | 9097 |
UniProt ID | P54578 |
Refseq Size | 4156 |
Cytogenetics | 18p11.32 |
Refseq ORF | 1482 |
Synonyms | TGT |
Summary | This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417492 | USP14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417492 | Transient overexpression lysate of ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 1 |
CNY 3,080.00 |
|
PH300337 | USP14 MS Standard C13 and N15-labeled recombinant protein (NP_005142) |
CNY 19,520.00 |
|
TP720168 | Recombinant protein of human ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (USP14), transcript variant 2 |
CNY 3,140.00 |