RPIP8 (RUNDC3A) (NM_006695) Human Recombinant Protein
CAT#: TP300211
Recombinant protein of human RUN domain containing 3A (RUNDC3A), transcript variant 2, 20 µg
View other "RPIP8" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200211 protein sequence
Red=Cloning site Green=Tags(s) MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILS HRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSE YITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLK DLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006686 |
Locus ID | 10900 |
UniProt ID | Q59EK9 |
Refseq Size | 1879 |
Cytogenetics | 17q21.31 |
Refseq ORF | 1215 |
Synonyms | RAP2IP; RPIP-8; RPIP8 |
Summary | May act as an effector of RAP2A in neuronal cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402004 | RUNDC3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428521 | RUNDC3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402004 | Transient overexpression lysate of RUN domain containing 3A (RUNDC3A), transcript variant 2 |
CNY 3,080.00 |
|
LY428521 | Transient overexpression lysate of RUN domain containing 3A (RUNDC3A), transcript variant 1 |
CNY 3,080.00 |
|
PH300211 | RUNDC3A MS Standard C13 and N15-labeled recombinant protein (NP_006686) |
CNY 19,520.00 |