United States
Germany
Japan
United Kingdom
China
NECAP2 (NM_001145277) Human Mass Spec Standard
CAT＃: PH327659
NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749)
View other "NECAP2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227659 |
| Predicted MW | 29.3 kDa |
| Protein Sequence |
>RC227659 representing NM_001145277
Red=Cloning site Green=Tags(s) MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG GSLVQPAVAPSSDQLPARPSQAQAGSSSDLSTVFPHVTSGKALPHLGQRKEDEALLSWPVFGA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138749 |
| RefSeq ORF | 819 |
| Locus ID | 55707 |
| Cytogenetics | 1p36.13 |
| Summary | This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC428781 | NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428782 | NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY428781 | Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 2 |
CNY 3,080.00 |
|
| LY428782 | Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 3 |
CNY 3,080.00 |
|
| PH327668 | NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138750) |
CNY 19,520.00 |
|
| TP327659 | Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327668 | Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP721003 | Purified recombinant protein of Human NECAP endocytosis associated 2 (NECAP2), transcript variant 1 |
CNY 3,140.00 |
