PSD93 (DLG2) (NM_001142702) Human Mass Spec Standard
CAT#: PH326876
DLG2 MS Standard C13 and N15-labeled recombinant protein (NP_001136174)
View other "PSD93" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DLG2 MS Standard C13 and N15-labeled recombinant protein (NP_001136174) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226876 |
Predicted MW | 38.2 kDa |
Protein Sequence |
>RC226876 representing NM_001142702
Red=Cloning site Green=Tags(s) MMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEG DSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQE INYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIE AGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQA KKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001136174 |
RefSeq ORF | 1002 |
Synonyms | chapsyn-110; PPP1R58; PSD-93; PSD93 |
Locus ID | 1740 |
Cytogenetics | 11q14.1 |
Summary | This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428249 | DLG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428251 | DLG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY428249 | Transient overexpression lysate of discs, large homolog 2 (Drosophila) (DLG2), transcript variant 1 |
CNY 4,840.00 |
|
LY428251 | Transient overexpression lysate of discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4 |
CNY 3,080.00 |
|
TP326876 | Recombinant protein of human discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP761236 | Purified recombinant protein of Human discs, large homolog 2 (Drosophila) (DLG2), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |