RNF185 (NM_001135825) Human Mass Spec Standard
CAT#: PH326760
RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297)
View other "RNF185" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226760 |
Predicted MW | 14 kDa |
Protein Sequence |
>RC226760 representing NM_001135825
Red=Cloning site Green=Tags(s) MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGF GFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129297 |
RefSeq ORF | 408 |
Locus ID | 91445 |
Cytogenetics | 22q12.2 |
Summary | E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1 (PubMed:21931693). Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation (PubMed:27485036). Protects cells from ER stress-induced apoptosis (PubMed:27485036). Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway (PubMed:24019521). Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2 (PubMed:24019521).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407689 | RNF185 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427719 | RNF185 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427720 | RNF185 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407689 | Transient overexpression lysate of ring finger protein 185 (RNF185), transcript variant 1 |
CNY 3,080.00 |
|
LY427719 | Transient overexpression lysate of ring finger protein 185 (RNF185), transcript variant 2 |
CNY 3,080.00 |
|
LY427720 | Transient overexpression lysate of ring finger protein 185 (RNF185), transcript variant 3 |
CNY 3,080.00 |
|
TP326760 | Purified recombinant protein of Homo sapiens ring finger protein 185 (RNF185), transcript variant 3, 20 µg |
CNY 2,900.00 |