PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Mass Spec Standard
CAT#: PH325775
PIK3R3 MS Standard C13 and N15-labeled recombinant protein (NP_001107644)
View other "PI 3 Kinase p55 gamma" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PIK3R3 MS Standard C13 and N15-labeled recombinant protein (NP_001107644) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225775 |
Predicted MW | 54.3 kDa |
Protein Sequence |
>RC225775 representing NM_001114172
Red=Cloning site Green=Tags(s) MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDI SREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY HHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQ MKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQD LKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENL PHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001107644 |
RefSeq ORF | 1383 |
Synonyms | p55; p55-GAMMA; p55PIK |
Locus ID | 8503 |
Cytogenetics | 1p34.1 |
Summary | Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene represents a regulatory subunit of PI3K. The encoded protein contains two SH2 domains through which it binds activated protein tyrosine kinases to regulate their activity. [provided by RefSeq, Jun 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Glioma, Insulin signaling pathway, Jak-STAT signaling pathway, Leukocyte transendothelial migration, Melanoma, mTOR signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Phosphatidylinositol signaling system, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401202 | PIK3R3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426469 | PIK3R3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401202 | Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1 |
CNY 3,080.00 |
|
LY426469 | Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2 |
CNY 3,080.00 |
|
TP325775 | Recombinant protein of human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它PI 3 Kinase p55 gamma产品