KCTD6 (NM_001128214) Human Mass Spec Standard
CAT#: PH325297
KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_001121686)
View other "KCTD6" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_001121686) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225297 |
Predicted MW | 27.6 kDa |
Protein Sequence |
>RC225297 protein sequence
Red=Cloning site Green=Tags(s) MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVII TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV HHMSERANENTVEHNWTFCRLARKTDD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001121686 |
RefSeq Size | 1566 |
RefSeq ORF | 711 |
Synonyms | KCASH3 |
Locus ID | 200845 |
Cytogenetics | 3p14.3 |
Summary | Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB) (PubMed:21472142). Involved in regulating protein levels of ANK1 isoform Mu17 probably implicating CUL3-dependent proteasomal degradation (PubMed:22573887).[UniProtKB/Swiss-Prot Function] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407050 | KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426928 | KCTD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407050 | Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1 |
CNY 3,080.00 |
|
LY426928 | Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2 |
CNY 3,080.00 |
|
PH305633 | KCTD6 MS Standard C13 and N15-labeled recombinant protein (NP_699162) |
CNY 19,520.00 |
|
TP305633 | Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325297 | Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 2, 20 µg |
CNY 2,900.00 |