Glutaredoxin 1 (GLRX) (NM_001118890) Human Mass Spec Standard
CAT#: PH325029
GLRX MS Standard C13 and N15-labeled recombinant protein (NP_001112362)
View other "Glutaredoxin 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GLRX MS Standard C13 and N15-labeled recombinant protein (NP_001112362) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225029 |
Predicted MW | 11.8 kDa |
Protein Sequence |
>RC225029 protein sequence
Red=Cloning site Green=Tags(s) MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001112362 |
RefSeq Size | 1093 |
RefSeq ORF | 318 |
Synonyms | GRX; GRX1 |
Locus ID | 2745 |
Cytogenetics | 5q15 |
Summary | This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400755 | GLRX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426531 | GLRX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400755 | Transient overexpression lysate of glutaredoxin (thioltransferase) (GLRX), transcript variant 1 |
CNY 3,080.00 |
|
LY426531 | Transient overexpression lysate of glutaredoxin (thioltransferase) (GLRX), transcript variant 2 |
CNY 3,080.00 |
|
PH319385 | GLRX MS Standard C13 and N15-labeled recombinant protein (NP_002055) |
CNY 19,520.00 |
|
TP319385 | Recombinant protein of human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325029 | Recombinant protein of human glutaredoxin (thioltransferase) (GLRX), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Glutaredoxin 1产品