TAL2 (NM_005421) Human Mass Spec Standard
CAT#: PH324692
TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412)
View other "TAL2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224692 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC224692 protein sequence
Red=Cloning site Green=Tags(s) MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005412 |
RefSeq Size | 656 |
RefSeq ORF | 324 |
Locus ID | 6887 |
Cytogenetics | 9q31.2 |
Summary | This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417315 | TAL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417315 | Transient overexpression lysate of T-cell acute lymphocytic leukemia 2 (TAL2) |
CNY 3,080.00 |
|
TP324692 | Recombinant protein of human T-cell acute lymphocytic leukemia 2 (TAL2), 20 µg |
CNY 2,900.00 |