VCX (NM_013452) Human Mass Spec Standard
CAT#: PH324497
VCX MS Standard C13 and N15-labeled recombinant protein (NP_038480)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | VCX MS Standard C13 and N15-labeled recombinant protein (NP_038480) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224497 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC224497 protein sequence
Red=Cloning site Green=Tags(s) MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESA PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQEAELEEPLSQESEVEEPLSQESQVEEPLSQESEV EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEEPLSQESQVEEPLSQESEMEELPSV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_038480 |
RefSeq Size | 976 |
RefSeq ORF | 618 |
Synonyms | VCX-10r; VCX-B1; VCX1; VCX10R; VCXB1 |
Locus ID | 26609 |
Cytogenetics | Xp22.31 |
Summary | This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 10 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415586 | VCX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415586 | Transient overexpression lysate of variable charge, X-linked (VCX) |
CNY 3,080.00 |
|
TP324497 | Recombinant protein of human variable charge, X-linked (VCX), 20 µg |
CNY 2,900.00 |